PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400007280
Common NameLOC102600380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 159aa    MW: 17666 Da    PI: 4.3659
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400007280genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB74.51.7e-231194386
                 NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                          ++d+ lP a +++i+k++lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l al  lGf +y+e++ + 
  PGSC0003DMP400007280 11 KEDASLPKATMTKIIKEMLPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREEKRTIAPEHVLKALQVLGFGEYIEEVYAA 94
                          6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.1E-388139IPR009072Histone-fold
SuperFamilySSF471132.01E-3412140IPR009072Histone-fold
PfamPF008081.4E-201479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MEPMDIVGKT KEDASLPKAT MTKIIKEMLP PDVRVARDTQ DLLIECCVEF INLISSESNE  60
VCNREEKRTI APEHVLKALQ VLGFGEYIEE VYAAYEQHKL ETMDTVRAGK CSNGAEMTEE  120
EALAEQQRMF AEARARMNGG VTGPPKQQDS EAEQTLNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-351213412133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-89HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755182e-89HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241619.11e-115PREDICTED: protein Dr1 homolog
RefseqXP_006354739.11e-115PREDICTED: protein Dr1 homolog
RefseqXP_015077062.11e-115PREDICTED: protein Dr1 homolog
SwissprotP495929e-91NC2B_ARATH; Protein Dr1 homolog
TrEMBLM0ZY191e-115M0ZY19_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000104361e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.47e-94nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]